PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00025.171
Common NameAMTR_s00025p00151950, LOC18440675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 280aa    MW: 31042.1 Da    PI: 6.9448
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00025.171genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.22.1e-343084155
                                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                              kprlrWt eLH+rFv+av+qLGG+ekAtPk+++++m+vkgLtl+h+kSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00025.171 30 KPRLRWTAELHQRFVDAVTQLGGPEKATPKSVMRIMDVKGLTLYHLKSHLQKYRL 84
                                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.5132787IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-332885IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-243085IPR006447Myb domain, plants
SuperFamilySSF466899.5E-173085IPR009057Homeodomain-like
PfamPF002498.6E-83283IPR001005SANT/Myb domain
PfamPF143792.6E-25136182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDSEANGSFR QIDGQDSSDS SRLILSADPK PRLRWTAELH QRFVDAVTQL GGPEKATPKS  60
VMRIMDVKGL TLYHLKSHLQ KYRLGKQTQR EAVINSNGRD VSLEEVTTVS DSSICLGSEN  120
RPTDTCSPTM VTDTLQISEA LRLQIEVQKS LHEQLEVQRH LQMRIEAQGK YLQSILEKAR  180
ETLARHHMGS AGIEETRREL SELSAKVSDG CRNPATFSLI GHQGLTGSQA KCEVLERLKK  240
KPMAPVLDLN SNLEPSNEDF GSGGCRKKEF DLNGFELGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006850876.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK54e-56APL_ARATH; Myb family transcription factor APL
TrEMBLW1PQZ00.0W1PQZ0_AMBTC; Uncharacterized protein
STRINGPP1S25_131V6.12e-66(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.13e-71G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]